PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 298aa    MW: 33832.7 Da    PI: 6.4171
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00319genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l + ++++G g+W++ ++  g++R++k+c++rw +yl
       AA10G00319 14 KGPWTPEEDEKLMKHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding59.47.8e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE+e +++++ +lG++ W++Ia +++ gRt++++k++w+++
       AA10G00319  67 RGNFTPEEEETIINLHSLLGNK-WSSIAGHLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.063961IPR017930Myb domain
SuperFamilySSF466895.62E-3311108IPR009057Homeodomain-like
SMARTSM007173.6E-151363IPR001005SANT/Myb domain
PfamPF002493.1E-171461IPR001005SANT/Myb domain
CDDcd001671.08E-111661No hitNo description
PROSITE profilePS5129427.97862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2865116IPR009057Homeodomain-like
SMARTSM007178.3E-1766114IPR001005SANT/Myb domain
PfamPF002495.7E-1767111IPR001005SANT/Myb domain
CDDcd001674.55E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLMKHIR KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TPEEEETIIN LHSLLGNKWS SIAGHLPGRT DNEIKNYWNT HIRKKLLQMG  120
IDPVTHRPRT DHLNVLNALP QLLAAANFNN LLNLNQTTQF DAASIAKAQL LHSMIQVLSN  180
NNNSAVFGQS SLLENNQNNQ NLFDYQAQNI QLSSQIGIVD DQNSNIPRLI SESCDEAKEI  240
VMSKNDNVNN VSNPSSTSTF TQDNNNQPWC DIIDDEASDS YWKDIIEQTC SEPWPFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29121165108B-MYB
1h8a_C6e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493101e-32AF249310.2 Arabidopsis thaliana putative transcription factor (MYB107) mRNA, complete cds.
GenBankAK2282681e-32AK228268.1 Arabidopsis thaliana mRNA for MYB family transcription factor like protein, complete cds, clone: RAFL14-72-D06.
GenBankAY5195831e-32AY519583.1 Arabidopsis thaliana MYB transcription factor (At3g02940) mRNA, complete cds.
GenBankBT0256601e-32BT025660.1 Arabidopsis thaliana At3g02940 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408360.11e-153hypothetical protein EUTSA_v10022405mg
RefseqXP_013591324.11e-154PREDICTED: transcription factor MYB3-like
RefseqXP_013729182.11e-154PREDICTED: transcription factor MYB3-like
SwissprotQ8GWP08e-82MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3AFX81e-153A0A0D3AFX8_BRAOL; Uncharacterized protein
TrEMBLV4MBG91e-153V4MBG9_EUTSA; Uncharacterized protein
STRINGAT5G16770.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.11e-131myb domain protein 107